PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013599758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 368aa    MW: 40824 Da    PI: 5.9449
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013599758.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-183883147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd  l ++v +lG+++W++Iar ++ gR++k+c++rw + 
   XP_013599758.1 38 KGPWSTEEDAVLTKLVSKLGPRNWSLIARGIP-GRSGKSCRLRWCNQ 83
                     79******************************.***********985 PP

2Myb_DNA-binding53.84.5e-1790134147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r++++ eEd  ++ a++ +G++ W+ Ia++++ gRt++ +k++w++ 
   XP_013599758.1  90 RKPFSDEEDHMIISAHAIHGNK-WAVIAKMLP-GRTDNAIKNHWNST 134
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4773388IPR017930Myb domain
SuperFamilySSF466899.38E-3135131IPR009057Homeodomain-like
SMARTSM007174.6E-153786IPR001005SANT/Myb domain
PfamPF002496.8E-173883IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-253991IPR009057Homeodomain-like
CDDcd001673.65E-144082No hitNo description
SMARTSM007179.9E-1689137IPR001005SANT/Myb domain
PROSITE profilePS5129421.45889139IPR017930Myb domain
PfamPF002491.6E-1590134IPR001005SANT/Myb domain
CDDcd001677.20E-1292135No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2392138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MDRSEPLPFP SSADSNEVTT AAAGDSSGGG YEIKSKVKGP WSTEEDAVLT KLVSKLGPRN  60
WSLIARGIPG RSGKSCRLRW CNQLDPCLKR KPFSDEEDHM IISAHAIHGN KWAVIAKMLP  120
GRTDNAIKNH WNSTLRRKYA DLWKNSNQVT TAYIKNENVE QQLPQEEIVS PPEVPQVVDV  180
PMYDEPTQVL DDVTMDDASP NEPQEQAPIE KSSIPVFRPV ARAGAFRVYN PNSQRNGYRD  240
QNVVPCEGPL IQAAKPDSLA GKFLQSLCGE PNIPSKCGHG CSTHPAEPGK SVLGAEFVDY  300
EEPCPVFNQE LISIATDLNN IAWIKSGLDN AIVREAEQNL KMDQITFNDP RIRFSGMMPR  360
QHFFCARS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-39371383104C-Myb DNA-Binding Domain
1msf_C5e-39371383104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747540.0KF974754.1 Brassica napus MYB transcription factor 109-1 (MYB109-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599758.10.0PREDICTED: uncharacterized protein LOC106307367
RefseqXP_013655918.10.0PREDICTED: uncharacterized protein LOC106360794
TrEMBLA0A078CB250.0A0A078CB25_BRANA; BnaC08g26660D protein
TrEMBLA0A0D3DTG30.0A0A0D3DTG3_BRAOL; Uncharacterized protein
STRINGBra007186.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.10.0myb domain protein 109